SUR1 and SUR2B Antibody is a Mouse Monoclonal antibody against SUR1 and SUR2B.
| Target |
SUR1 and SUR2B |
| Reactivity |
Mouse, Rat |
| Host |
Mouse |
| Clonality |
Monoclonal |
| Tested Applications |
WB, IF/ICC |
| Recommended dilutions |
WB: 1/1000, IHC: 1/1000, IF/ICC: 1/100. Optimal dilutions/concentrations should be determined by the end user. |
| Immunogen |
Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B |
| Purification |
Protein G Purified |
| Isotype |
IgG1 |
| Conjugation |
Unconjugated |
| Specificity |
Detects ~175kDa and smaller fragments likely due to proteolytic cleavage. |
| Storage |
Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| Swiss Prot |
Q63563
|
| GeneID |
25560
|
| NCBI Accession |
NP_037172.2
|
| Concentration |
1 mg/ml |
| Buffer |
PBS, pH 7.4, 50% glycerol, 0.09% sodium azide. |
| UNSPSC Code |
12352203 |
| Availability |
Shipped within 5-12 working days. |
| Note |
This product is for research use only. |