| Edit |   |
|---|
| Antigenic Specificity | Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression. |
|---|
| Immunogen | NR1 H4 antibody was raised using the middle region of NR1 4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI |
|---|
| Other Names | zgc:110190|zgc:92742|NR1H4|BAR|FXR|HRR-1|HRR1|RIP14|AI957360|Fxr|Rxrip14 |
|---|
| Gene, Accession # | Gene ID: 9971 |
|---|
| Catalog # | ABIN630514 |
|---|
| Price | |
|---|
| Order / More Info | Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|