| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Melanoma antigen family C2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Melanoma antigen family C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Melanoma antigen family C2. This antibody reacts with human. The Melanoma antigen family C2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MAGEC2 (melanoma antigen family C, 2) The peptide sequence was selected from the N terminal of MAGEC2. Peptide sequence SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF. |
|---|
| Other Names | Cancer/testis antigen 10, CT10MAGE-E1 antigen, HCA587MAGE-C2, hepatocellular cancer antigen 587, Hepatocellular carcinoma-associated antigen 587, MAGE-C2 antigen, MAGEE1MGC13377, melanoma antigen family C, 2, melanoma antigen, family E, 1, cancer/testis specific, melanoma-associated antigen C2 |
|---|
| Gene, Accession # | MAGEC2, Gene ID: 51438, Accession: Q9UBF1, SwissProt: Q9UBF1 |
|---|
| Catalog # | NBP1-68961-20ul |
|---|
| Price | |
|---|
| Order / More Info | Melanoma antigen family C2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|