| Edit |   |
| Antigenic Specificity | GLIPR1L1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GLIPR1L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLIPR1L1. This antibody reacts with human. The GLIPR1L1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GLIPR1L1 (GLI pathogenesis-related 1 like 1) The peptide sequence was selected from the middle region of GLIPR1L1. Peptide sequence NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL. |
| Other Names | ALKN2972, GLI pathogenesis-related 1 like 1, GLIPR1-like protein 1, MGC26856, PRO7434 |
| Gene, Accession # | GLIPR1L1, Gene ID: 256710 |
| Catalog # | NBP1-57060 |
| Price | |
| Order / More Info | GLIPR1L1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |