| 产品详情 |
| Edit |   |
| Antigenic Specificity | HLA DRB1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HLA DRB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HLA DRB1. This antibody reacts with human. The HLA DRB1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DRB1 (developmentally regulated RNA-binding protein 1) The peptide sequence was selected from the N terminal of DRB1. Peptide sequence MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD. |
| Other Names | Clone P2-beta-3, DR1, DR-1, DR12, DR-12, DR13, DR-13, DR14, DR-14, DR16, DR-16, DR4, DR-4, DR5, DR-5, DR7, DR-7, DR8, DR-8, DR9, DR-9, DRB1, DRw10, DRw11, DRw8, DW2.2/DR2.2, FLJ75017, FLJ76359, HLA class II antigen beta chain, HLA class II histocompatibility antigen, DR-1 beta chain, HLA-DR1B, HLA-DRB, HLA-DRB1*, HLA-DRB2, HLA-DR-beta 1, human leucocyte antigen DRB1, leucocyte antigen DR beta 1 chain, leucocyte antigen DRB1, lymphocyte antigen DRB1, major histocompatibility complex, class II, DR beta 1, MHC class II antigen DRB1*1, MHC class II antigen DRB1*10, MHC class II antigen DRB1*11, MHC class II antigen DRB1*12, MHC class II antigen DRB1*13, MHC class II antigen DRB1*14, MHC class II antigen DRB1*15, MHC class II antigen DRB1*16, MHC class II antigen DRB1*3, MHC class II antigen DRB1*4, MHC class II antigen DRB1*7, MHC class II antigen DRB1*8, MHC class II antigen DRB1*9, MHC class II antigen HLA-DR13, MHC class II HLA-DR beta 1 chain, MHC class II HLA-DR-beta cell surface gly |
| Gene, Accession # | HLA-DRB1, Gene ID: 3123, Accession: Q8IUH3-3, SwissProt: Q8IUH3-3 |
| Catalog # | NBP1-57247 |
| Price | |
| Order / More Info | HLA DRB1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|