| 产品详情 |
| Edit |   |
| Antigenic Specificity | ENPP-2/Autotaxin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ENPP-2/Autotaxin Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENPP-2/Autotaxin. This antibody reacts with human. The ENPP-2/Autotaxin Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ENPP-2/Autotaxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT |
| Other Names | ATXFLJ26803, ATX-X, AUTOTAXIN, autotaxin-t, EC 3.1.4.39, ectonucleotide pyrophosphatase/phosphodiesterase 2, ectonucleotide pyrophosphatase/phosphodiesterase family member 2, E-NPP 2, Extracellular lysophospholipase D, LysoPLD, PD-IALPHA, PDNP2NPP2, phosphodiesterase I/nucleotide pyrophosphatase 2, plasma lysophospholipase D |
| Gene, Accession # | ENPP2, Gene ID: 5168 |
| Catalog # | NBP2-58482 |
| Price | |
| Order / More Info | ENPP-2/Autotaxin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|