| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ENPP-2/Autotaxin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ENPP-2/Autotaxin Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENPP-2/Autotaxin. This antibody reacts with human. The ENPP-2/Autotaxin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2) The peptide sequence was selected from the N terminal of ENPP2)(50ug). Peptide sequence YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA. |
|---|
| Other Names | ATXFLJ26803, ATX-X, AUTOTAXIN, autotaxin-t, EC 3.1.4.39, ectonucleotide pyrophosphatase/phosphodiesterase 2, ectonucleotide pyrophosphatase/phosphodiesterase family member 2, E-NPP 2, Extracellular lysophospholipase D, LysoPLD, PD-IALPHA, PDNP2NPP2, phosphodiesterase I/nucleotide pyrophosphatase 2, plasma lysophospholipase D |
|---|
| Gene, Accession # | ENPP2, Gene ID: 5168, Accession: Q13822, SwissProt: Q13822 |
|---|
| Catalog # | NBP1-59852 |
|---|
| Price | |
|---|
| Order / More Info | ENPP-2/Autotaxin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|