| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Granzyme A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Granzyme A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Granzyme A. This antibody reacts with human. The Granzyme A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Granzyme A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGG |
|---|
| Other Names | CTL tryptase, CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease), Cytotoxic T-lymphocyte proteinase 1, EC 3.4.21, fragmentin-1, granzyme A, granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3), Granzyme-1, H factor, Hanukkah factor, HF, HFSPEC 3.4.21.78 |
|---|
| Gene, Accession # | GZMA, Gene ID: 3001, Accession: P12544, SwissProt: P12544 |
|---|
| Catalog # | NBP2-38717 |
|---|
| Price | |
|---|
| Order / More Info | Granzyme A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|