| 产品详情 |
| Edit |   |
| Antigenic Specificity | PAC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PAC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAC2. This antibody reacts with human. The PAC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PAC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLP |
| Other Names | CLAST3HSPC260, HCCA3PAC-2, hepatocellular carcinoma susceptibility protein, Hepatocellular carcinoma-susceptibility protein 3, HsT1707, likely ortholog of mouse CD40 ligand-activated specific transcript 3 (Clast3), MDS003, MGC15092, PAC2HDCMC29P, proteasome (prosome, macropain) assembly chaperone 2, proteasome assembling chaperone 2, proteasome assembly chaperone 2, TNFSF5IP1CD40 ligand-activated specific transcript 3, Tumor necrosis factor superfamily member 5-induced protein 1, tumor necrosis factor superfamily, member 5-induced protein 1, x 003 protein |
| Gene, Accession # | PSMG2, Gene ID: 56984, Accession: Q969U7, SwissProt: Q969U7 |
| Catalog # | NBP2-30574 |
| Price | |
| Order / More Info | PAC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|