| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD9 |
|---|
| Clone | 4A2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD9 Antibody (4A2) from Novus Biologicals is a mouse monoclonal antibody to CD9. This antibody reacts with human. The CD9 Antibody (4A2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | CD9 (AAH11988 112 a.a. - 195 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
|---|
| Other Names | BA2, BA-2/p24 antigen, BTCC-1, CD9 antigen, CD9 molecule, Cell growth-inhibiting gene 2 protein, DRAP-27, Leukocyte antigen MIC3, motility related protein-1,5H9 antigen, Motility-related protein, MRP-1FLJ99568, P24, Tetraspanin-29, TSPAN-29, TSPAN29MIC3CD9 antigen (p24) |
|---|
| Gene, Accession # | CD9, Gene ID: 928, Accession: AAH11988, SwissProt: AAH11988 |
|---|
| Catalog # | H00000928-M01 |
|---|
| Price | |
|---|
| Order / More Info | CD9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|