| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AIMP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AIMP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AIMP2. This antibody reacts with human. The AIMP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AIMP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQ |
|---|
| Other Names | aminoacyl tRNA synthase complex-interacting multifunctional protein 2, aminoacyl tRNA synthetase complex-interacting multifunctional protein 2, ARS-interacting multi-functional protein 2, JTV1JTV-1, Multisynthase complex auxiliary component p38, multisynthetase complex auxiliary component p38, p38, PRO0992, Protein JTV-1 |
|---|
| Gene, Accession # | AIMP2, Gene ID: 7965, Accession: Q13155, SwissProt: Q13155 |
|---|
| Catalog # | NBP1-81574 |
|---|
| Price | |
|---|
| Order / More Info | AIMP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|