| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SRD5A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRD5A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRD5A3. This antibody reacts with human. The SRD5A3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SRD5A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYL |
|---|
| Other Names | 3-oxo-5-alpha-steroid 4-dehydrogenase 3, CDG1P, EC 1.3.1.-, EC 1.3.99.5, FLJ13352, probable polyprenol reductase, S5AR 3, SR type 3, SRD5A2L1, SRD5A2LCDG1Q, steroid 5 alpha-reductase 3, Steroid 5-alpha-reductase 2-like, Steroid 5-alpha-reductase 3 |
|---|
| Gene, Accession # | SRD5A3, Gene ID: 79644 |
|---|
| Catalog # | NBP1-82259 |
|---|
| Price | |
|---|
| Order / More Info | SRD5A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|