| Edit |   |
|---|
| Antigenic Specificity | Calcitonin-Gene related Peptide 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Goat |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | serum |
|---|
| Size | 20ul 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | RIA |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Recognizes human Calcitonin-Gene related Peptide 2. There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin. |
|---|
| Immunogen | Synthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF) |
|---|
| Other Names | Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2) |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | C0115-03 |
|---|
| Price | |
|---|
| Order / More Info | Calcitonin-Gene related Peptide 2 Antibody from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|