| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VISTA/B7-H5/PD-1H |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VISTA/B7-H5/PD-1H Antibody from Novus Biologicals is a rabbit polyclonal antibody to VISTA/B7-H5/PD-1H. This antibody reacts with human. The VISTA/B7-H5/PD-1H Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VISTA/B7-H5/PD-1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS |
|---|
| Other Names | B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR |
|---|
| Gene, Accession # | VSIR, Gene ID: 64115 |
|---|
| Catalog # | NBP1-88967 |
|---|
| Price | |
|---|
| Order / More Info | VISTA/B7-H5/PD-1H Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|