| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP7b |
|---|
| Clone | 3E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP7b Antibody (3E10) from Novus Biologicals is a mouse monoclonal antibody to ATP7b. This antibody reacts with human. The ATP7b Antibody (3E10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ATP7B (NP_000044, 1372 a.a. - 1465 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI |
|---|
| Other Names | ATPase, Cu(2+)- transporting, beta polypeptide, ATPase, Cu++ transporting, beta polypeptide, Copper pump 2, copper-transporting ATPase 2, EC 3.6.3, EC 3.6.3.4, PWD, WC1, WD, Wilson disease-associated protein, WNDATPase, Cu++ transporting, beta polypeptide (Wilson disease) |
|---|
| Gene, Accession # | ATP7B, Gene ID: 540, Accession: NP_000044, SwissProt: NP_000044 |
|---|
| Catalog # | H00000540-M01 |
|---|
| Price | |
|---|
| Order / More Info | ATP7b Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19237514 |
|---|
| 产品资料 |
|
|