| 产品详情 |
| Edit |   |
| Antigenic Specificity | ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2. This antibody reacts with human. The ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected form the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. |
| Other Names | Alpha 2,3-ST 2, Beta-galactoside alpha-2,3-sialyltransferase 2, beta-galactoside alpha-2,3-sialytransferase, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2, EC 2.4.99.4, EC 2.4.99.7, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4B, sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase), SIAT4B, SIAT4-B, ST3 beta-galactoside alpha-2,3-sialyltransferase 2, ST3GalA.2ST3Gal II, ST3GALII |
| Gene, Accession # | ST3GAL2, Gene ID: 6483, Accession: Q16842, SwissProt: Q16842 |
| Catalog # | NBP1-62558 |
| Price | |
| Order / More Info | ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|