| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GRHL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRHL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRHL3. This antibody reacts with human. The GRHL3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GRHL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL |
|---|
| Other Names | grainyhead-like 3 (Drosophila), MGC46624, Sister of mammalian grainyhead, sister-of-mammalian grainyhead, SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog, TFCP2L4, transcription factor hSOM1 |
|---|
| Gene, Accession # | GRHL3, Gene ID: 57822 |
|---|
| Catalog # | NBP2-57087 |
|---|
| Price | |
|---|
| Order / More Info | GRHL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|