| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SERPINB13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SERPINB13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SERPINB13. This antibody reacts with human. The SERPINB13 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SERPINB13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE |
|---|
| Other Names | HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13, serpin B13, serpin peptidase inhibitor, clade B (ovalbumin), member 13, UV-B repressed sequence, HUR 7 |
|---|
| Gene, Accession # | SERPINB13, Gene ID: 5275, Accession: Q9UIV8, SwissProt: Q9UIV8 |
|---|
| Catalog # | NBP2-38821 |
|---|
| Price | |
|---|
| Order / More Info | SERPINB13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|