| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AKAP11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AKAP11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKAP11. This antibody reacts with human. The AKAP11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AKAP11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM |
|---|
| Other Names | A kinase (PRKA) anchor protein 11, AKAP 220, AKAP-11, AKAP220hAKAP220, A-kinase anchor protein 220 kDa, A-kinase anchoring protein, 220kDa, DKFZp781I12161, FLJ11304, KIAA0629a kinase anchor protein 220 kDa, PRKA11A-kinase anchor protein 11, protein kinase A anchoring protein 11, Protein kinase A-anchoring protein 11 |
|---|
| Gene, Accession # | AKAP11, Gene ID: 11215, Accession: Q9UKA4, SwissProt: Q9UKA4 |
|---|
| Catalog # | NBP1-89169 |
|---|
| Price | |
|---|
| Order / More Info | AKAP11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|