| Edit |   |
|---|
| Antigenic Specificity | Activin C/Inhibin beta C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Activin C/Inhibin beta C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Activin C/Inhibin beta C. This antibody reacts with human. The Activin C/Inhibin beta C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is INHBC - N-terminal region. Peptide sequence QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN. |
|---|
| Other Names | inhibin beta C chain, IHBC, inhibin, beta C |
|---|
| Gene, Accession # | INHBC, Gene ID: 3626, Accession: NP_005529, SwissProt: NP_005529 |
|---|
| Catalog # | NBP1-98297-20ul |
|---|
| Price | |
|---|
| Order / More Info | Activin C/Inhibin beta C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|