| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Integrin alpha 2/CD49b |
|---|
| Clone | CL7318 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin alpha 2/CD49b Antibody (CL7318) from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha 2/CD49b. This antibody reacts with human. The Integrin alpha 2/CD49b Antibody (CL7318) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV |
|---|
| Other Names | alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2 |
|---|
| Gene, Accession # | ITGA2, Gene ID: 3673 |
|---|
| Catalog # | NBP2-76483 |
|---|
| Price | |
|---|
| Order / More Info | Integrin alpha 2/CD49b Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|