| Edit |   |
|---|
| Antigenic Specificity | Ankyrin repeat domain 39 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ankyrin repeat domain 39 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ankyrin repeat domain 39. This antibody reacts with human. The Ankyrin repeat domain 39 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ankyrin repeat domain 39 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE |
|---|
| Other Names | ankyrin repeat domain 39, ankyrin repeat domain-containing protein 39, MGC41816 |
|---|
| Gene, Accession # | ANKRD39, Gene ID: 51239, Accession: Q53RE8, SwissProt: Q53RE8 |
|---|
| Catalog # | NBP1-91673 |
|---|
| Price | |
|---|
| Order / More Info | Ankyrin repeat domain 39 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|