| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CKAP4/p63 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CKAP4/p63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CKAP4/p63. This antibody reacts with human. The CKAP4/p63 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CKAP4/p63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES |
|---|
| Other Names | 63 kDa membrane protein, CLIMP-63, cytoskeleton-associated protein 4, ERGIC-63, MGC99554, P63, transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment, type-II transmembrane protein p63 |
|---|
| Gene, Accession # | CKAP4, Gene ID: 10970 |
|---|
| Catalog # | NBP2-55266 |
|---|
| Price | |
|---|
| Order / More Info | CKAP4/p63 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|