| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LEDGF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LEDGF Antibody from Novus Biologicals is a rabbit polyclonal antibody to LEDGF. This antibody reacts with human. The LEDGF Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LEDGF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ |
|---|
| Other Names | CLL-associated antigen KW-7, Dense fine speckles 70 kDa protein, DFS70, LEDGFDFS 70, Lens epithelium-derived growth factor, MGC74712, p52, p75, PAIP, PC4 and SFRS1 interacting protein 1, PC4 and SFRS1 interacting protein 2, PC4 and SFRS1-interacting protein, PSIP2, transcriptional coactivator p52/p75, Transcriptional coactivator p75/p52 |
|---|
| Gene, Accession # | PSIP1, Gene ID: 11168 |
|---|
| Catalog # | NBP1-87885 |
|---|
| Price | |
|---|
| Order / More Info | LEDGF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|