| Edit |   |
| Antigenic Specificity | Neuromedin BR/NMBR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Neuromedin BR/NMBR Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuromedin BR/NMBR. This antibody reacts with human. The Neuromedin BR/NMBR Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NMBR(neuromedin B receptor) The peptide sequence was selected from the N terminal of NMBR. Peptide sequence PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL. |
| Other Names | neuromedin B receptor, neuromedin-B receptor, Neuromedin-B-preferring bombesin receptor, NMB-R |
| Gene, Accession # | NMBR, Gene ID: 4829, Accession: P28336, SwissProt: P28336 |
| Catalog # | NBP1-59024 |
| Price | |
| Order / More Info | Neuromedin BR/NMBR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |