| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Neuromedin UR1/NMUR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neuromedin UR1/NMUR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuromedin UR1/NMUR1. This antibody reacts with human. The Neuromedin UR1/NMUR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Neuromedin U R1/NMUR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP |
|---|
| Other Names | (FM-3), FM3, FM-3, G protein-coupled receptor 66, GPC-R, GPR66G-protein coupled receptor 66, G-protein coupled receptor FM-3, neuromedin U receptor 1, neuromedin-U receptor 1, NMU1R, NMU-R1 |
|---|
| Gene, Accession # | NMUR1, Gene ID: 10316 |
|---|
| Catalog # | NBP1-83433 |
|---|
| Price | |
|---|
| Order / More Info | Neuromedin UR1/NMUR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|