| Edit |   |
| Antigenic Specificity | Mitocondrial Translational Initiation Factor 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Mitocondrial Translational Initiation Factor 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mitocondrial Translational Initiation Factor 3. This antibody reacts with human. The Mitocondrial Translational Initiation Factor 3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MTIF3(mitochondrial translational initiation factor 3) The peptide sequence was selected from the middle region of MTIF3. Peptide sequence AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ. |
| Other Names | FLJ33676, IF3(mt), IF-3mt, mitochondrial, mitochondrial translational initiation factor 3 |
| Gene, Accession # | MTIF3, Gene ID: 219402, Accession: Q9H2K0, SwissProt: Q9H2K0 |
| Catalog # | NBP1-54978-20ul |
| Price | |
| Order / More Info | Mitocondrial Translational Initiation Factor 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |