| 产品详情 |
| Edit |   |
| Antigenic Specificity | Mitofilin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Mitofilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mitofilin. This antibody reacts with human. The Mitofilin Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Mitofilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARM |
| Other Names | DKFZp779P1653, inner membrane protein, mitochondrial, MGC111146, Mic 60, Mic60, MICOS Complex Subunit MIC60, mitochondrial (mitofilin), mitofilin, motor protein, p87/89, proliferation-inducing gene 4 |
| Gene, Accession # | IMMT, Gene ID: 10989, Accession: Q16891, SwissProt: Q16891 |
| Catalog # | NBP2-38285 |
| Price | |
| Order / More Info | Mitofilin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|