| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Mitofusin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Mitofusin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mitofusin 1. This antibody reacts with human. The Mitofusin 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Mitofusin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGL |
|---|
| Other Names | DKFZp762F247, EC 3.6.5, EC 3.6.5.-, FLJ20693, Fzo homolog, hfzo1, hfzo2, MGC41806, mitochondrial transmembrane GTPase Fzo-1, mitochondrial transmembrane GTPase FZO-2, mitofusin 1, mitofusin-1, putative transmembrane GTPase, Transmembrane GTPase MFN1 |
|---|
| Gene, Accession # | MFN1, Gene ID: 55669 |
|---|
| Catalog # | NBP2-57125 |
|---|
| Price | |
|---|
| Order / More Info | Mitofusin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|