| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RLTPR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RLTPR Antibody from Novus Biologicals is a rabbit polyclonal antibody to RLTPR. This antibody reacts with human. The RLTPR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RLTPR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ |
|---|
| Other Names | CARMIL2, CARMIL2b, leucine rich repeat containing 16C, leucine-rich repeat-containing protein 16C, LRRC16C, RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing, RGD, leucine-rich repeat, tropomodulin and proline-rich containing protein, RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein |
|---|
| Gene, Accession # | RLTPR, Gene ID: 146206 |
|---|
| Catalog # | NBP1-91220 |
|---|
| Price | |
|---|
| Order / More Info | RLTPR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|