| Edit |   |
|---|
| Antigenic Specificity | ARHGAP15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARHGAP15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGAP15. This antibody reacts with human. The ARHGAP15 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARHGAP15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRP |
|---|
| Other Names | ArhGAP15, BM046, Rho GTPase activating protein 15, rho GTPase-activating protein 15, Rho-type GTPase-activating protein 15 |
|---|
| Gene, Accession # | ARHGAP15, Gene ID: 55843, Accession: Q53QZ3, SwissProt: Q53QZ3 |
|---|
| Catalog # | NBP1-88577 |
|---|
| Price | |
|---|
| Order / More Info | ARHGAP15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|