| Edit |   |
| Antigenic Specificity | ARHGAP15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARHGAP15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGAP15. This antibody reacts with human. The ARHGAP15 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ARHGAP15(Rho GTPase activating protein 15) The peptide sequence was selected from the middle region of ARHGAP15. Peptide sequence VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ. |
| Other Names | ArhGAP15, BM046, Rho GTPase activating protein 15, rho GTPase-activating protein 15, Rho-type GTPase-activating protein 15 |
| Gene, Accession # | ARHGAP15, Gene ID: 55843, Accession: Q53QZ3, SwissProt: Q53QZ3 |
| Catalog # | NBP1-56885-20ul |
| Price | |
| Order / More Info | ARHGAP15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |