| Edit |   |
|---|
| Antigenic Specificity | ARHGAP18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARHGAP18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGAP18. This antibody reacts with human. The ARHGAP18 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ARHGAP18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STTIKVMEKPPFDRSISQDSLDELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESI |
|---|
| Other Names | bA307O14.2, MacGAP, MGC126757, Rho GTPase activating protein 18, rho-type GTPase-activating protein 18 |
|---|
| Gene, Accession # | ARHGAP18, Gene ID: 93663, Accession: Q8N392, SwissProt: Q8N392 |
|---|
| Catalog # | NBP1-94131 |
|---|
| Price | |
|---|
| Order / More Info | ARHGAP18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|