| Edit |   |
|---|
| Antigenic Specificity | ARHGAP36 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARHGAP36 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGAP36. This antibody reacts with human. The ARHGAP36 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of RP13 102H20. 1. Immunizing peptide sequence KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH. |
|---|
| Other Names | FLJ30058, Rho GTPase activating protein 36, rho GTPase-activating protein 36 |
|---|
| Gene, Accession # | ARHGAP36, Gene ID: 158763, Accession: Q6ZRI8, SwissProt: Q6ZRI8 |
|---|
| Catalog # | NBP1-74250 |
|---|
| Price | |
|---|
| Order / More Info | ARHGAP36 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|