| Edit |   |
|---|
| Antigenic Specificity | Lebercilin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lebercilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lebercilin. This antibody reacts with human. The Lebercilin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Lebercilin. The peptide sequence was selected from the N terminal of Lebercilin. Peptide sequence FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST. |
|---|
| Other Names | C6orf152Leber congenital amaurosis 5 protein, chromosome 6 open reading frame 152, Leber congenital amaurosis 5, Lebercilin |
|---|
| Gene, Accession # | LCA5, Gene ID: 167691, Accession: Q86VQ0, SwissProt: Q86VQ0 |
|---|
| Catalog # | NBP1-55416 |
|---|
| Price | |
|---|
| Order / More Info | Lebercilin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|