| Edit |   |
|---|
| Antigenic Specificity | RAB6C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAB6C Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB6C. This antibody reacts with human. The RAB6C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF. |
|---|
| Other Names | RAB6C, member RAS oncogene family, ras-related protein Rab-6C, WTH3Rab6-like protein WTH3 |
|---|
| Gene, Accession # | RAB6C, Gene ID: 84084, Accession: Q9H0N0, SwissProt: Q9H0N0 |
|---|
| Catalog # | NBP1-74265-20ul |
|---|
| Price | |
|---|
| Order / More Info | RAB6C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|