| 产品详情 |
| Edit |   |
| Antigenic Specificity | RAB11FIP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RAB11FIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB11FIP3. This antibody reacts with human. The RAB11FIP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RAB11FIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ |
| Other Names | ARFO1, Arfophilin-1, EF hands-containing Rab-interacting protein, Eferin, FIP3-Rab11, KIAA0665arfophilin-1, MU-MB-17.148, PAC196A12.1, RAB11 family interacting protein 3 (class II), rab11-family interacting protein 3, Rab11-FIP3rab11 family-interacting protein 3 |
| Gene, Accession # | RAB11FIP3, Gene ID: 9727 |
| Catalog # | NBP1-84000 |
| Price | |
| Order / More Info | RAB11FIP3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24462247 |
| 产品资料 |
|
|