| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP7A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP7A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP7A. This antibody reacts with human. The ATP7A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ATP7A (ATPase, Cu++ transporting, alpha polypeptide, Menkes syndrome). The peptide sequence was selected from the N-terminal of ATP7A. Peptide sequence MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ |
|---|
| Other Names | ATPase, Cu++ transporting, alpha polypeptide, Copper pump 1, copper-transporting ATPase 1, Cu++-transporting P-type ATPase, DSMAX, EC 3.6.3, EC 3.6.3.4, MC1, Menkes disease-associated protein, Menkes syndrome, MK, MNKFLJ17790, OHS, SMAX3 |
|---|
| Gene, Accession # | ATP7A, Gene ID: 538, Accession: Q04656, SwissProt: Q762B6 |
|---|
| Catalog # | NBP1-54906-100ul |
|---|
| Price | |
|---|
| Order / More Info | ATP7A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|