| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP8A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP8A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP8A1. This antibody reacts with human. The ATP8A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ATP8A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI |
|---|
| Other Names | probable phospholipid-transporting ATPase IA, ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1, ATPASEII, ATPIA, ATPP2 |
|---|
| Gene, Accession # | ATP8A1, Gene ID: 10396, Accession: Q9Y2Q0, SwissProt: Q9Y2Q0 |
|---|
| Catalog # | NBP2-30403 |
|---|
| Price | |
|---|
| Order / More Info | ATP8A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|