| Edit |   |
|---|
| Antigenic Specificity | Ketohexokinase |
|---|
| Clone | 2B1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ketohexokinase Antibody (2B1) from Novus Biologicals is a mouse monoclonal antibody to Ketohexokinase. This antibody reacts with human. The Ketohexokinase Antibody (2B1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | KHK (NP_000212 201 a.a. - 297 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGI |
|---|
| Other Names | EC 2.7.1.3, Hepatic fructokinase, ketohexokinase, ketohexokinase (fructokinase) |
|---|
| Gene, Accession # | KHK, Gene ID: 3795, Accession: NP_000212, SwissProt: NP_000212 |
|---|
| Catalog # | H00003795-M07 |
|---|
| Price | |
|---|
| Order / More Info | Ketohexokinase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|