| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C. This antibody reacts with human. The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK |
|---|
| Other Names | EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA0780FLJ25949, lysine (K)-specific demethylase 4C, lysine-specific demethylase 4C |
|---|
| Gene, Accession # | KDM4C, Gene ID: 23081 |
|---|
| Catalog # | NBP2-57484 |
|---|
| Price | |
|---|
| Order / More Info | Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|