| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SCFD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCFD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCFD2. This antibody reacts with human. The SCFD2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SCFD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ARPDKRKLGSLGDVDSTTLTPELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQVIAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTGAV |
|---|
| Other Names | FLJ21060, FLJ39514, sec1 family domain containing 2, STXBP1L1sec1 family domain-containing protein 2, syntaxin binding protein 1-like 1, Syntaxin-binding protein 1-like 1 |
|---|
| Gene, Accession # | SCFD2, Gene ID: 152579 |
|---|
| Catalog # | NBP1-81925 |
|---|
| Price | |
|---|
| Order / More Info | SCFD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|