| Edit |   |
|---|
| Antigenic Specificity | SCFD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCFD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCFD2. This antibody reacts with mouse. The SCFD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human Scfd2The immunogen for this antibody is Scfd2. Peptide sequence LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS. |
|---|
| Other Names | FLJ21060, FLJ39514, sec1 family domain containing 2, STXBP1L1sec1 family domain-containing protein 2, syntaxin binding protein 1-like 1, Syntaxin-binding protein 1-like 1 |
|---|
| Gene, Accession # | Scfd2, Gene ID: 152579, Accession: NP_848787 |
|---|
| Catalog # | NBP1-79522 |
|---|
| Price | |
|---|
| Order / More Info | SCFD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|