| Edit |   |
|---|
| Antigenic Specificity | PPP1R35 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP1R35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R35. This antibody reacts with human. The PPP1R35 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPP1R35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA |
|---|
| Other Names | C7orf47, Chromosome 7 Open Reading Frame 47, Protein Phosphatase 1 Regulatory Subunit 35, Protein Phosphatase 1, Regulatory Subunit 35, UPF0683 Protein C7orf47 |
|---|
| Gene, Accession # | PPP1R35, Gene ID: 221908, Accession: Q8TAP8, SwissProt: Q8TAP8 |
|---|
| Catalog # | NBP2-30996 |
|---|
| Price | |
|---|
| Order / More Info | PPP1R35 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|