| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FPR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID : 29057162). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FPR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FPR1. This antibody reacts with human, mouse. The FPR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse FPR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT |
|---|
| Other Names | fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor |
|---|
| Gene, Accession # | FPR1, Gene ID: 2357 |
|---|
| Catalog # | NBP2-47452 |
|---|
| Price | |
|---|
| Order / More Info | FPR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29057162 |
|---|
| 产品资料 |
|
|