| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FPRL1/FPR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FPRL1/FPR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FPRL1/FPR2. This antibody reacts with human. The FPRL1/FPR2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FPRL1/FPR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTYCTFNFASWGGTPEERLKVAITMLTARG |
|---|
| Other Names | ALXR, FMLP-R-II, FMLPX, formyl peptide receptor 2, Formyl peptide receptor-like 1RFP, FPR2A, FPRH1FMLP-related receptor I, FPRL1LXA4 receptor, HM63FPRH2, Lipoxin A4 receptor, lipoxin A4 receptor (formyl peptide receptor related), LXA4RFMLP-R-I, N-formyl peptide receptor 2 |
|---|
| Gene, Accession # | FPR2, Gene ID: 2358 |
|---|
| Catalog # | NBP1-90180 |
|---|
| Price | |
|---|
| Order / More Info | FPRL1/FPR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|