| Edit |   |
| Antigenic Specificity | ABCC12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABCC12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCC12. This antibody reacts with human. The ABCC12 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABCC12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWLTPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRV |
| Other Names | ATP-binding cassette transporter sub-family C member 12, ATP-binding cassette, sub-family C (CFTR/MRP), member 12, MGC27071, MRP9ATP-binding cassette sub-family C member 12, multidrug resistance-associated protein 9 |
| Gene, Accession # | ABCC12, Gene ID: 94160, Accession: Q96J65 |
| Catalog # | NBP1-81034 |
| Price | |
| Order / More Info | ABCC12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |