| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATPB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATPB Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATPB. This antibody reacts with human. The ATPB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: beta, mitochondrial |
|---|
| Immunogen | Synthetic peptides corresponding to ATP5B(ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide) The peptide sequence was selected from the N terminal of ATP5B. Peptide sequence PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAP |
|---|
| Other Names | ATP synthase subunit beta, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, ATPMB, ATPSBmitochondrial ATP synthase beta subunit, EC 3.6.3, EC 3.6.3.14, MGC5231, mitochondrial ATP synthetase, beta subunit |
|---|
| Gene, Accession # | ATP5B, Gene ID: 506, Accession: P06576, SwissProt: P06576 |
|---|
| Catalog # | NBP1-54700 |
|---|
| Price | |
|---|
| Order / More Info | ATPB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23824910 |
|---|
| 产品资料 |
|
|