| 产品详情 |
| Edit |   |
| Antigenic Specificity | LMP2/PSMB9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LMP2/PSMB9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMP2/PSMB9. This antibody reacts with human. The LMP2/PSMB9 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human LMP2/PSMB9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG |
| Other Names | beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1 |
| Gene, Accession # | PSMB9, Gene ID: 5698 |
| Catalog # | NBP2-55229 |
| Price | |
| Order / More Info | LMP2/PSMB9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|