| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LMP7/PSMB8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LMP7/PSMB8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMP7/PSMB8. This antibody reacts with human. The LMP7/PSMB8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LMP7/PSMB8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
|---|
| Other Names | beta5i, D6S216E, EC 3.4.25.1, LMP7MGC1491, Low molecular mass protein 7, low molecular weight protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, protease component C13, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7), proteasome catalytic subunit 3i, Proteasome component C13, proteasome subunit beta 5i, proteasome subunit beta type-8, Proteasome subunit beta-5i, proteasome subunit Y2, proteasome-related gene 7, PSMB5iD6S216, Really interesting new gene 10 protein, RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7), Y2 |
|---|
| Gene, Accession # | PSMB8, Gene ID: 5696 |
|---|
| Catalog # | NBP2-47396 |
|---|
| Price | |
|---|
| Order / More Info | LMP7/PSMB8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|